PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3134s0024.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 341aa    MW: 38488.8 Da    PI: 6.9866
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3134s0024.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33.1e-323387155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprl+Wt++LH+rF+eav+qLGG++kAtPk ++++m+++gLtl+h+kSHLQkYRl
  Araha.3134s0024.1.p 33 KPRLKWTCDLHHRFIEAVNQLGGPNKATPKGLMKVMEIPGLTLYHLKSHLQKYRL 87
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-283188IPR009057Homeodomain-like
SuperFamilySSF466894.66E-153287IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-223388IPR006447Myb domain, plants
PfamPF002498.9E-63586IPR001005SANT/Myb domain
PfamPF143795.6E-23136182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MCLLMEINNN ANNNNTNNNH KAKMSLVLST DAKPRLKWTC DLHHRFIEAV NQLGGPNKAT  60
PKGLMKVMEI PGLTLYHLKS HLQKYRLGKS MKFDDNKLEV SSASENQEAE SKNDSRDLRG  120
CSVTEENSNP AKEGLQITEA LQMQMEVQKK LHEQIEVQRH LQVKIEAQGK YLQSVLMKAQ  180
QTLAGYSSST LGMDFARTEL SRLASMVNRG CPSSSFSELT QVEEEEEAEE GFLWCKKPEN  240
RGISQLRCSV ESSLTSSESS EIKLENDNNL NKLIELPLME IKSEVITGKK RSLNDVVCVE  300
QKPLMKRAFG VDDDEHLKLS LNSYKKDMET CPKSEHRTRV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0295160.0BT029516.1 Arabidopsis thaliana At1g69580 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010470954.10.0PREDICTED: uncharacterized protein LOC104750801 isoform X4
RefseqXP_010512004.10.0PREDICTED: uncharacterized protein LOC104788022 isoform X2
TrEMBLF4I2740.0F4I274_ARATH; Homeodomain-like superfamily protein
STRINGfgenesh2_kg.2__1223__AT1G69580.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.10.0G2-like family protein